Protein Description: WNK lysine deficient protein kinase 3
Gene Name: WNK3
Alternative Gene Name: PRKWNK3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041245: 59%, ENSRNOG00000002537: 41%
Entrez Gene ID: 65267
Uniprot ID: Q9BYP7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: WNK3
Alternative Gene Name: PRKWNK3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041245: 59%, ENSRNOG00000002537: 41%
Entrez Gene ID: 65267
Uniprot ID: Q9BYP7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | SSQPSVAYSSNQTMGSQMVSNIPQAEVNVPGQIYSSQQLVGHYQQVSGLQKHSKLTQPQILPLVQGQSTVLPVHVLGPTVVSQPQVSPLTVQKV |
Documents & Links for Anti WNK3 pAb (ATL-HPA077678) | |
Datasheet | Anti WNK3 pAb (ATL-HPA077678) Datasheet (External Link) |
Vendor Page | Anti WNK3 pAb (ATL-HPA077678) at Atlas |
Documents & Links for Anti WNK3 pAb (ATL-HPA077678) | |
Datasheet | Anti WNK3 pAb (ATL-HPA077678) Datasheet (External Link) |
Vendor Page | Anti WNK3 pAb (ATL-HPA077678) |