Protein Description: wntless Wnt ligand secretion mediator
Gene Name: WLS
Alternative Gene Name: C1orf139, EVI, FLJ23091, GPR177, mig-14, MRP, wls
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028173: 94%, ENSRNOG00000036816: 93%
Entrez Gene ID: 79971
Uniprot ID: Q5T9L3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: WLS
Alternative Gene Name: C1orf139, EVI, FLJ23091, GPR177, mig-14, MRP, wls
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028173: 94%, ENSRNOG00000036816: 93%
Entrez Gene ID: 79971
Uniprot ID: Q5T9L3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LAYRDDAFAEWTEMAHERVPRKLKCTFTSPKTPEHEGRYYECDVLPFMEIGSVAHKFYLLNIRLPVNEKKKINVGIGEIKD |
| Documents & Links for Anti WLS pAb (ATL-HPA069520) | |
| Datasheet | Anti WLS pAb (ATL-HPA069520) Datasheet (External Link) |
| Vendor Page | Anti WLS pAb (ATL-HPA069520) at Atlas |
| Documents & Links for Anti WLS pAb (ATL-HPA069520) | |
| Datasheet | Anti WLS pAb (ATL-HPA069520) Datasheet (External Link) |
| Vendor Page | Anti WLS pAb (ATL-HPA069520) |