Protein Description: WNT1 inducible signaling pathway protein 3
Gene Name: WISP3
Alternative Gene Name: CCN6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062074: 56%, ENSRNOG00000000597: 56%
Entrez Gene ID: 8838
Uniprot ID: O95389
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: WISP3
Alternative Gene Name: CCN6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062074: 56%, ENSRNOG00000000597: 56%
Entrez Gene ID: 8838
Uniprot ID: O95389
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | GTGPLDTTPEGRPGEVSDAPQRKQFCHWPCKCPQQKPRCPPGV |
Documents & Links for Anti WISP3 pAb (ATL-HPA078340) | |
Datasheet | Anti WISP3 pAb (ATL-HPA078340) Datasheet (External Link) |
Vendor Page | Anti WISP3 pAb (ATL-HPA078340) at Atlas |
Documents & Links for Anti WISP3 pAb (ATL-HPA078340) | |
Datasheet | Anti WISP3 pAb (ATL-HPA078340) Datasheet (External Link) |
Vendor Page | Anti WISP3 pAb (ATL-HPA078340) |