Anti WDR70 pAb (ATL-HPA048149)

Atlas Antibodies

SKU:
ATL-HPA048149-25
  • Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in Leydig cells.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: WD repeat domain 70
Gene Name: WDR70
Alternative Gene Name: FLJ10233
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039828: 98%, ENSRNOG00000013336: 98%
Entrez Gene ID: 55100
Uniprot ID: Q9NW82
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KPEPPVAGPGRGGRVGTHGGTLSSYIVKNIALDKTDDSNPREAILRHAKAAEDSPYWVSPAYSKTQPKTMFAQVESDDEEAKNEPEW
Gene Sequence KPEPPVAGPGRGGRVGTHGGTLSSYIVKNIALDKTDDSNPREAILRHAKAAEDSPYWVSPAYSKTQPKTMFAQVESDDEEAKNEPEW
Gene ID - Mouse ENSMUSG00000039828
Gene ID - Rat ENSRNOG00000013336
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti WDR70 pAb (ATL-HPA048149)
Datasheet Anti WDR70 pAb (ATL-HPA048149) Datasheet (External Link)
Vendor Page Anti WDR70 pAb (ATL-HPA048149) at Atlas Antibodies

Documents & Links for Anti WDR70 pAb (ATL-HPA048149)
Datasheet Anti WDR70 pAb (ATL-HPA048149) Datasheet (External Link)
Vendor Page Anti WDR70 pAb (ATL-HPA048149)