Anti WDR55 pAb (ATL-HPA048143)

Atlas Antibodies

SKU: ATL-HPA048143-25

• 
• 

Protein Description: WD repeat domain 55
Gene Name: WDR55
Alternative Gene Name: FLJ20195, FLJ21702
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042660: 94%, ENSRNOG00000017251: 96%
Entrez Gene ID: 54853
Uniprot ID: Q9H6Y2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VSKAHGAPINSLLLVDENVLATGDDTGGIRLWDQRKEGPLMDMRQHEEYIADMALDPAKKLLLTASGDGCLGIFNIKRRRFELLSEPQSGDLT
• Gene Sequence: VSKAHGAPINSLLLVDENVLATGDDTGGIRLWDQRKEGPLMDMRQHEEYIADMALDPAKKLLLTASGDGCLGIFNIKRRRFELLSEPQSGDLT
• Gene ID - Mouse: ENSMUSG00000042660
• Gene ID - Rat: ENSRNOG00000017251
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.