Anti WDR54 pAb (ATL-HPA053558 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA053558-25
  • Immunohistochemistry analysis in human fallopian tube and liver tissues using Anti-WDR54 antibody. Corresponding WDR54 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line MCF7 shows positivity in mitochondria & vesicles.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: WD repeat domain 54
Gene Name: WDR54
Alternative Gene Name: FLJ12953
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030032: 83%, ENSRNOG00000060514: 81%
Entrez Gene ID: 84058
Uniprot ID: Q9H977
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TTGNLHVQINAHARAICALDLASEVGKLLSAGEDTFVHIWKLSRNPESGYIEVEHCHGECVADTQLCGARFCDSSGNSFAVTGYDL
Gene Sequence TTGNLHVQINAHARAICALDLASEVGKLLSAGEDTFVHIWKLSRNPESGYIEVEHCHGECVADTQLCGARFCDSSGNSFAVTGYDL
Gene ID - Mouse ENSMUSG00000030032
Gene ID - Rat ENSRNOG00000060514
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti WDR54 pAb (ATL-HPA053558 w/enhanced validation)
Datasheet Anti WDR54 pAb (ATL-HPA053558 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti WDR54 pAb (ATL-HPA053558 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti WDR54 pAb (ATL-HPA053558 w/enhanced validation)
Datasheet Anti WDR54 pAb (ATL-HPA053558 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti WDR54 pAb (ATL-HPA053558 w/enhanced validation)