Anti WDR44 pAb (ATL-HPA046719)

Atlas Antibodies

SKU:
ATL-HPA046719-25
  • Immunofluorescent staining of human cell line A-431 shows localization to the Golgi apparatus.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: WD repeat domain 44
Gene Name: WDR44
Alternative Gene Name: DKFZp686L20145, RAB11BP, RPH11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036769: 100%, ENSRNOG00000029068: 100%
Entrez Gene ID: 54521
Uniprot ID: Q5JSH3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VIGTYDGRCIFYDTEHLKYHTQIHVRSTRGRNKVGRKITGIEPLPGENKILVTSNDSRIRLYDLRDLSLSMKYKG
Gene Sequence VIGTYDGRCIFYDTEHLKYHTQIHVRSTRGRNKVGRKITGIEPLPGENKILVTSNDSRIRLYDLRDLSLSMKYKG
Gene ID - Mouse ENSMUSG00000036769
Gene ID - Rat ENSRNOG00000029068
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti WDR44 pAb (ATL-HPA046719)
Datasheet Anti WDR44 pAb (ATL-HPA046719) Datasheet (External Link)
Vendor Page Anti WDR44 pAb (ATL-HPA046719) at Atlas Antibodies

Documents & Links for Anti WDR44 pAb (ATL-HPA046719)
Datasheet Anti WDR44 pAb (ATL-HPA046719) Datasheet (External Link)
Vendor Page Anti WDR44 pAb (ATL-HPA046719)