Anti WDR33 pAb (ATL-HPA046527)

Atlas Antibodies

SKU: ATL-HPA046527-25

• 

Protein Description: WD repeat domain 33
Gene Name: WDR33
Alternative Gene Name: FLJ11294, NET14, WDC146
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024400: 99%, ENSRNOG00000011382: 99%
Entrez Gene ID: 55339
Uniprot ID: Q9C0J8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LAWHPLGHILCSGSNDHTSKFWTRNRPGDKMRDRYNLNLLPGMSEDGVEYDDLEPNSLAVIPGMGIPEQLKLAMEQEQMGKDESNEIEMTIPGLDWGMEEVMQKDQKKVPQKKVPYAKPIPAQFQQAWMQNKVPIP
• Gene Sequence: LAWHPLGHILCSGSNDHTSKFWTRNRPGDKMRDRYNLNLLPGMSEDGVEYDDLEPNSLAVIPGMGIPEQLKLAMEQEQMGKDESNEIEMTIPGLDWGMEEVMQKDQKKVPQKKVPYAKPIPAQFQQAWMQNKVPIP
• Gene ID - Mouse: ENSMUSG00000024400
• Gene ID - Rat: ENSRNOG00000011382
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.