![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/1280x1280/products/101022/181056/atl-hpa072915_anti-wdr3-pab-atl-hpa072915_62724__18269.1681137294.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil")
![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/101022/181056/atl-hpa072915_anti-wdr3-pab-atl-hpa072915_62724__18269.1681137294.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil")
Protein Description: WD repeat domain 3
Gene Name: WDR3
Alternative Gene Name: DIP2, FLJ12796, UTP12
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033285: 83%, ENSRNOG00000019670: 83%
Entrez Gene ID: 10885
Uniprot ID: Q9UNX4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: WDR3
Alternative Gene Name: DIP2, FLJ12796, UTP12
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033285: 83%, ENSRNOG00000019670: 83%
Entrez Gene ID: 10885
Uniprot ID: Q9UNX4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | ARKKAKLHSSKGEEEDPEVNVEMSLQDEIQRVTNIKTSAKIKSFDLIHSPHGELKAVFLLQNNLVELYSLNPSLPTPQPVRTSRITIG |
| Documents & Links for Anti WDR3 pAb (ATL-HPA072915) | |
| Datasheet | Anti WDR3 pAb (ATL-HPA072915) Datasheet (External Link) |
| Vendor Page | Anti WDR3 pAb (ATL-HPA072915) at Atlas |
| Documents & Links for Anti WDR3 pAb (ATL-HPA072915) | |
| Datasheet | Anti WDR3 pAb (ATL-HPA072915) Datasheet (External Link) |
| Vendor Page | Anti WDR3 pAb (ATL-HPA072915) |