Anti WDR3 pAb (ATL-HPA072915)

Atlas Antibodies

SKU: ATL-HPA072915-25

• 

Protein Description: WD repeat domain 3
Gene Name: WDR3
Alternative Gene Name: DIP2, FLJ12796, UTP12
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033285: 83%, ENSRNOG00000019670: 83%
Entrez Gene ID: 10885
Uniprot ID: Q9UNX4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ARKKAKLHSSKGEEEDPEVNVEMSLQDEIQRVTNIKTSAKIKSFDLIHSPHGELKAVFLLQNNLVELYSLNPSLPTPQPVRTSRITIG
• Gene Sequence: ARKKAKLHSSKGEEEDPEVNVEMSLQDEIQRVTNIKTSAKIKSFDLIHSPHGELKAVFLLQNNLVELYSLNPSLPTPQPVRTSRITIG
• Gene ID - Mouse: ENSMUSG00000033285
• Gene ID - Rat: ENSRNOG00000019670
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.