Anti WDR18 pAb (ATL-HPA050200 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA050200-100
  • Immunohistochemical staining of human duodenum shows strong cytoplasmic and membranous positivity in glandular cells.
  • Western blot analysis using Anti-WDR18 antibody HPA050200 (A) shows similar pattern to independent antibody HPA050193 (B).
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: WD repeat domain 18
Gene Name: WDR18
Alternative Gene Name: Ipi3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035754: 85%, ENSRNOG00000012379: 83%
Entrez Gene ID: 57418
Uniprot ID: Q9BV38
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AEHHMFCGGSEGSIFQVDLFTWPGQRERSFHPEQDAGKVFKGHRNQVTCLSVSTDGSVLLSGSHDETVRLWDVQSKQCIR
Gene Sequence AEHHMFCGGSEGSIFQVDLFTWPGQRERSFHPEQDAGKVFKGHRNQVTCLSVSTDGSVLLSGSHDETVRLWDVQSKQCIR
Gene ID - Mouse ENSMUSG00000035754
Gene ID - Rat ENSRNOG00000012379
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti WDR18 pAb (ATL-HPA050200 w/enhanced validation)
Datasheet Anti WDR18 pAb (ATL-HPA050200 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti WDR18 pAb (ATL-HPA050200 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti WDR18 pAb (ATL-HPA050200 w/enhanced validation)
Datasheet Anti WDR18 pAb (ATL-HPA050200 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti WDR18 pAb (ATL-HPA050200 w/enhanced validation)



Citations for Anti WDR18 pAb (ATL-HPA050200 w/enhanced validation) – 1 Found
Gordon, Jacob; Chapus, Fleur L; Viverette, Elizabeth G; Williams, Jason G; Deterding, Leesa J; Krahn, Juno M; Borgnia, Mario J; Rodriguez, Joseph; Warren, Alan J; Stanley, Robin E. Cryo-EM reveals the architecture of the PELP1-WDR18 molecular scaffold. Nature Communications. 2022;13(1):6783.  PubMed