Anti WDFY3 pAb (ATL-HPA048572)

Atlas Antibodies

SKU:
ATL-HPA048572-25
  • Immunohistochemical staining of human duodenum shows strong cytoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line A549 shows localization to nucleoli & cytosol.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: WD repeat and FYVE domain containing 3
Gene Name: WDFY3
Alternative Gene Name: ALFY, KIAA0993, ZFYVE25
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043940: 100%, ENSRNOG00000061121: 100%
Entrez Gene ID: 23001
Uniprot ID: Q8IZQ1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RVVDKLWQGMFNKESKLLIDFIIQLIAQSKRRSQGLSLDAVYHCLNRTILYQFSRAHKTVPQQVALLDSLRVLTVNRNLILGPGNHDQEFISCL
Gene Sequence RVVDKLWQGMFNKESKLLIDFIIQLIAQSKRRSQGLSLDAVYHCLNRTILYQFSRAHKTVPQQVALLDSLRVLTVNRNLILGPGNHDQEFISCL
Gene ID - Mouse ENSMUSG00000043940
Gene ID - Rat ENSRNOG00000061121
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti WDFY3 pAb (ATL-HPA048572)
Datasheet Anti WDFY3 pAb (ATL-HPA048572) Datasheet (External Link)
Vendor Page Anti WDFY3 pAb (ATL-HPA048572) at Atlas Antibodies

Documents & Links for Anti WDFY3 pAb (ATL-HPA048572)
Datasheet Anti WDFY3 pAb (ATL-HPA048572) Datasheet (External Link)
Vendor Page Anti WDFY3 pAb (ATL-HPA048572)