Anti WDFY2 pAb (ATL-HPA050094)

Atlas Antibodies

SKU: ATL-HPA050094-25

• 
• 

Protein Description: WD repeat and FYVE domain containing 2
Gene Name: WDFY2
Alternative Gene Name: ZFYVE22
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014547: 100%, ENSRNOG00000010042: 98%
Entrez Gene ID: 115825
Uniprot ID: Q96P53
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VCDSCHEAITDEERAPTATFHDSKHNIVHVHFDATRGWLLTSGTDKVIKLWDM
• Gene Sequence: VCDSCHEAITDEERAPTATFHDSKHNIVHVHFDATRGWLLTSGTDKVIKLWDM
• Gene ID - Mouse: ENSMUSG00000014547
• Gene ID - Rat: ENSRNOG00000010042
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.