Anti WDFY1 pAb (ATL-HPA050603)
Atlas Antibodies
- SKU:
- ATL-HPA050603-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: WDFY1
Alternative Gene Name: FENS-1, KIAA1435, WDF1, ZFYVE17
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073643: 99%, ENSRNOG00000015080: 95%
Entrez Gene ID: 57590
Uniprot ID: Q8IWB7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SIYHTMASPCSAMAYHHDSRRIFVGQDNGAVMEFHVSEDFNKMNFIKTYPAHQNRVSAIIFSLATEWVISTGH |
| Gene Sequence | SIYHTMASPCSAMAYHHDSRRIFVGQDNGAVMEFHVSEDFNKMNFIKTYPAHQNRVSAIIFSLATEWVISTGH |
| Gene ID - Mouse | ENSMUSG00000073643 |
| Gene ID - Rat | ENSRNOG00000015080 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti WDFY1 pAb (ATL-HPA050603) | |
| Datasheet | Anti WDFY1 pAb (ATL-HPA050603) Datasheet (External Link) |
| Vendor Page | Anti WDFY1 pAb (ATL-HPA050603) at Atlas Antibodies |
| Documents & Links for Anti WDFY1 pAb (ATL-HPA050603) | |
| Datasheet | Anti WDFY1 pAb (ATL-HPA050603) Datasheet (External Link) |
| Vendor Page | Anti WDFY1 pAb (ATL-HPA050603) |
| Citations for Anti WDFY1 pAb (ATL-HPA050603) – 1 Found |
| Sancho-Balsells, Anna; Brito, Veronica; Fernández, Belissa; Pardo, Mónica; Straccia, Marco; Ginés, Silvia; Alberch, Jordi; Hernández, Isabel; Arranz, Belén; Canals, Josep M; Giralt, Albert. Lack of Helios During Neural Development Induces Adult Schizophrenia-Like Behaviors Associated With Aberrant Levels of the TRIF-Recruiter Protein WDFY1. Frontiers In Cellular Neuroscience. 14( 32477064):93. PubMed |