Anti WBSCR22 pAb (ATL-HPA052185)

Atlas Antibodies

SKU: ATL-HPA052185-25

• 
• 

Protein Description: Williams Beuren syndrome chromosome region 22
Gene Name: WBSCR22
Alternative Gene Name: MERM1, MGC19709, MGC2022, MGC5140, PP3381, WBMT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005378: 80%, ENSRNOG00000033700: 80%
Entrez Gene ID: 114049
Uniprot ID: O43709
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ELFYDETEARKYVRNSRMIDIQTRMAGRALELLYLPENKPCYLLDIGCGTGLSGSYLSDEGHYWVGLDISPAMLDE
• Gene Sequence: ELFYDETEARKYVRNSRMIDIQTRMAGRALELLYLPENKPCYLLDIGCGTGLSGSYLSDEGHYWVGLDISPAMLDE
• Gene ID - Mouse: ENSMUSG00000005378
• Gene ID - Rat: ENSRNOG00000033700
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti WBSCR22 pAb (ATL-HPA052185) – 1 Found

Zorbas, Christiane; Nicolas, Emilien; Wacheul, Ludivine; Huvelle, Emmeline; Heurgué-Hamard, Valérie; Lafontaine, Denis L J. The human 18S rRNA base methyltransferases DIMT1L and WBSCR22-TRMT112 but not rRNA modification are required for ribosome biogenesis. Molecular Biology Of The Cell. 2015;26(11):2080-95.