Anti WBP11 pAb (ATL-HPA046403)

Atlas Antibodies

SKU: ATL-HPA046403-25

• 
• 

Protein Description: WW domain binding protein 11
Gene Name: WBP11
Alternative Gene Name: NPWBP, PPP1R165, SIPP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030216: 86%, ENSRNOG00000049593: 86%
Entrez Gene ID: 51729
Uniprot ID: Q9Y2W2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QRKSEDNSAVPLAKAAPKSGPSVPVSVQTKDDVYEDFMKEME
• Gene Sequence: QRKSEDNSAVPLAKAAPKSGPSVPVSVQTKDDVYEDFMKEME
• Gene ID - Mouse: ENSMUSG00000030216
• Gene ID - Rat: ENSRNOG00000049593
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.