Anti WBP1 pAb (ATL-HPA057067)
Atlas Antibodies
- SKU:
- ATL-HPA057067-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: WBP1
Alternative Gene Name: WBP-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030035: 75%, ENSRNOG00000061902: 73%
Entrez Gene ID: 23559
Uniprot ID: Q96G27
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | DSGIELCPCPASGEGEPVKEVRVSATLPDLEDYSPCALPPESVPQIFPMGLSSSEG |
Gene Sequence | DSGIELCPCPASGEGEPVKEVRVSATLPDLEDYSPCALPPESVPQIFPMGLSSSEG |
Gene ID - Mouse | ENSMUSG00000030035 |
Gene ID - Rat | ENSRNOG00000061902 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti WBP1 pAb (ATL-HPA057067) | |
Datasheet | Anti WBP1 pAb (ATL-HPA057067) Datasheet (External Link) |
Vendor Page | Anti WBP1 pAb (ATL-HPA057067) at Atlas Antibodies |
Documents & Links for Anti WBP1 pAb (ATL-HPA057067) | |
Datasheet | Anti WBP1 pAb (ATL-HPA057067) Datasheet (External Link) |
Vendor Page | Anti WBP1 pAb (ATL-HPA057067) |