Anti WBP1 pAb (ATL-HPA057067)

Atlas Antibodies

SKU: ATL-HPA057067-25

• 
• 

Protein Description: WW domain binding protein 1
Gene Name: WBP1
Alternative Gene Name: WBP-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030035: 75%, ENSRNOG00000061902: 73%
Entrez Gene ID: 23559
Uniprot ID: Q96G27
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DSGIELCPCPASGEGEPVKEVRVSATLPDLEDYSPCALPPESVPQIFPMGLSSSEG
• Gene Sequence: DSGIELCPCPASGEGEPVKEVRVSATLPDLEDYSPCALPPESVPQIFPMGLSSSEG
• Gene ID - Mouse: ENSMUSG00000030035
• Gene ID - Rat: ENSRNOG00000061902
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.