Protein Description: WASH complex subunit 5
Gene Name: WASHC5
Alternative Gene Name: KIAA0196, SPG8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022350: 98%, ENSRNOG00000009739: 98%
Entrez Gene ID: 9897
Uniprot ID: Q12768
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: WASHC5
Alternative Gene Name: KIAA0196, SPG8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022350: 98%, ENSRNOG00000009739: 98%
Entrez Gene ID: 9897
Uniprot ID: Q12768
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | HRGLIFNPRAKPSELMPKLKELGATMDGFHRSFEYIQDYVNIYGLKIWQEEVSRIINYNVEQECNNFLRTKIQDWQSMYQSTHIPIPKFTPVD |
| Gene ID - Mouse | ENSMUSG00000022350 |
| Gene ID - Rat | ENSMUSG00000022350 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti WASHC5 pAb (ATL-HPA070916) | |
| Datasheet | Anti WASHC5 pAb (ATL-HPA070916) Datasheet (External Link) |
| Vendor Page | Anti WASHC5 pAb (ATL-HPA070916) at Atlas |
| Documents & Links for Anti WASHC5 pAb (ATL-HPA070916) | |
| Datasheet | Anti WASHC5 pAb (ATL-HPA070916) Datasheet (External Link) |
| Vendor Page | Anti WASHC5 pAb (ATL-HPA070916) |