Anti WASHC2A pAb (ATL-HPA047844)

Atlas Antibodies

SKU:
ATL-HPA047844-25
  • Immunohistochemical staining of human gallbladder shows strong cytoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli, cytosol & vesicles.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: WASH complex subunit 2A
Gene Name: WASHC2A
Alternative Gene Name: bA56A21.1, bA98I6.1, FAM21A, FAM21B, FLJ10824
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024104: 94%, ENSRNOG00000011653: 91%
Entrez Gene ID: 387680
Uniprot ID: Q641Q2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VRVYDEEVEEPVLKAEAEKTEQEKTREQKEVDLIPKVQEAVNYGLQVLDSAFEQLDIKAGNSDSEEDDANGRVELILEPKDLYIDRPLPYLIGSKLFME
Gene Sequence VRVYDEEVEEPVLKAEAEKTEQEKTREQKEVDLIPKVQEAVNYGLQVLDSAFEQLDIKAGNSDSEEDDANGRVELILEPKDLYIDRPLPYLIGSKLFME
Gene ID - Mouse ENSMUSG00000024104
Gene ID - Rat ENSRNOG00000011653
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti WASHC2A pAb (ATL-HPA047844)
Datasheet Anti WASHC2A pAb (ATL-HPA047844) Datasheet (External Link)
Vendor Page Anti WASHC2A pAb (ATL-HPA047844) at Atlas Antibodies

Documents & Links for Anti WASHC2A pAb (ATL-HPA047844)
Datasheet Anti WASHC2A pAb (ATL-HPA047844) Datasheet (External Link)
Vendor Page Anti WASHC2A pAb (ATL-HPA047844)