Anti VWC2 pAb (ATL-HPA055243)

Atlas Antibodies

SKU: ATL-HPA055243-25

• 
• 

Protein Description: von Willebrand factor C domain containing 2
Gene Name: VWC2
Alternative Gene Name: PSST739, UNQ739
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050830: 73%, ENSRNOG00000049076: 72%
Entrez Gene ID: 375567
Uniprot ID: Q2TAL6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KLKQAWVSQGGGAKAGDLQVRPRGDTPQAEALAAAAQDAIGPELAPTPEPPEEYVYPDYR
• Gene Sequence: KLKQAWVSQGGGAKAGDLQVRPRGDTPQAEALAAAAQDAIGPELAPTPEPPEEYVYPDYR
• Gene ID - Mouse: ENSMUSG00000050830
• Gene ID - Rat: ENSRNOG00000049076
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.