Anti VWA7 pAb (ATL-HPA054262)

Atlas Antibodies

SKU: ATL-HPA054262-25

• 

Protein Description: von Willebrand factor A domain containing 7
Gene Name: VWA7
Alternative Gene Name: C6orf27, G7c, NG37
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007030: 86%, ENSRNOG00000000860: 79%
Entrez Gene ID: 80737
Uniprot ID: Q9Y334
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VVPVLLELSGPSGFLAPGSKVPLSLRIASFSGPQDLDLRTFVNPSFSLTSNLSRAHLELNESAWGRLWLEVPDSAAPDSVVMVTVTAGGREANPVPPTHAFLRLL
• Gene Sequence: VVPVLLELSGPSGFLAPGSKVPLSLRIASFSGPQDLDLRTFVNPSFSLTSNLSRAHLELNESAWGRLWLEVPDSAAPDSVVMVTVTAGGREANPVPPTHAFLRLL
• Gene ID - Mouse: ENSMUSG00000007030
• Gene ID - Rat: ENSRNOG00000000860
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.