Anti VTN pAb (ATL-HPA060933)

Atlas Antibodies

SKU:
ATL-HPA060933-25
  • Immunohistochemical staining of human kidney shows distinct positivity in plasma.
  • Immunofluorescent staining of human cell line CACO-2 shows localization to endoplasmic reticulum & vesicles.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: vitronectin
Gene Name: VTN
Alternative Gene Name: VN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017344: 58%, ENSRNOG00000010031: 58%
Entrez Gene ID: 7448
Uniprot ID: P04004
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KCQCDELCSYYQSCCTDYTAECKPQVTRGDVFTMPEDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPE
Gene Sequence KCQCDELCSYYQSCCTDYTAECKPQVTRGDVFTMPEDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPE
Gene ID - Mouse ENSMUSG00000017344
Gene ID - Rat ENSRNOG00000010031
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti VTN pAb (ATL-HPA060933)
Datasheet Anti VTN pAb (ATL-HPA060933) Datasheet (External Link)
Vendor Page Anti VTN pAb (ATL-HPA060933) at Atlas Antibodies

Documents & Links for Anti VTN pAb (ATL-HPA060933)
Datasheet Anti VTN pAb (ATL-HPA060933) Datasheet (External Link)
Vendor Page Anti VTN pAb (ATL-HPA060933)