Anti VTI1A pAb (ATL-HPA054108)

Atlas Antibodies

SKU: ATL-HPA054108-25

• 
• 
• 

Protein Description: vesicle transport through interaction with t-SNAREs 1A
Gene Name: VTI1A
Alternative Gene Name: MVti1, Vti1-rp2, Vti1a
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024983: 76%, ENSRNOG00000042786: 80%
Entrez Gene ID: 143187
Uniprot ID: Q96AJ9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SSRRLEAGYQIAVETEQIGQEMLENLSHDREKIQRARERLRETDANLGKSSRILTGMLRRGCSVKKQCNLSLAPK
• Gene Sequence: SSRRLEAGYQIAVETEQIGQEMLENLSHDREKIQRARERLRETDANLGKSSRILTGMLRRGCSVKKQCNLSLAPK
• Gene ID - Mouse: ENSMUSG00000024983
• Gene ID - Rat: ENSRNOG00000042786
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.