Anti VTCN1 pAb (ATL-HPA054200)

Atlas Antibodies

SKU: ATL-HPA054200-25

• 
• 

Protein Description: V-set domain containing T cell activation inhibitor 1
Gene Name: VTCN1
Alternative Gene Name: B7-H4, B7H4, B7S1, B7X, FLJ22418
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051076: 85%, ENSRNOG00000015279: 85%
Entrez Gene ID: 79679
Uniprot ID: Q7Z7D3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRL
• Gene Sequence: ISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRL
• Gene ID - Mouse: ENSMUSG00000051076
• Gene ID - Rat: ENSRNOG00000015279
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti VTCN1 pAb (ATL-HPA054200) – 2 Found

Song, Xinxin; Zhou, Zhuan; Li, Hongchun; Xue, Yifan; Lu, Xinghua; Bahar, Ivet; Kepp, Oliver; Hung, Mien-Chie; Kroemer, Guido; Wan, Yong. Pharmacologic Suppression of B7-H4 Glycosylation Restores Antitumor Immunity in Immune-Cold Breast Cancers. Cancer Discovery. 2020;10(12):1872-1893. 

Wang, Ya-Qin; Zhang, Yu; Jiang, Wei; Chen, Yu-Pei; Xu, Shuo-Yu; Liu, Na; Zhao, Yin; Li, Li; Lei, Yuan; Hong, Xiao-Hong; Liang, Ye-Lin; Li, Jun-Yan; Zhang, Lu-Lu; Yun, Jing-Ping; Sun, Ying; Li, Ying-Qin; Ma, Jun. Development and validation of an immune checkpoint-based signature to predict prognosis in nasopharyngeal carcinoma using computational pathology analysis. Journal For Immunotherapy Of Cancer. 2019;7(1):298.