Protein Description: V-set and transmembrane domain containing 5
Gene Name: VSTM5
Alternative Gene Name: C11orf90, LOC387804
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031937: 83%, ENSRNOG00000010480: 83%
Entrez Gene ID: 387804
Uniprot ID: A8MXK1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: VSTM5
Alternative Gene Name: C11orf90, LOC387804
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031937: 83%, ENSRNOG00000010480: 83%
Entrez Gene ID: 387804
Uniprot ID: A8MXK1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | NKCAYKFQRKRRHKLKESTTEEIELEDVEC |
Documents & Links for Anti VSTM5 pAb (ATL-HPA063591) | |
Datasheet | Anti VSTM5 pAb (ATL-HPA063591) Datasheet (External Link) |
Vendor Page | Anti VSTM5 pAb (ATL-HPA063591) at Atlas |
Documents & Links for Anti VSTM5 pAb (ATL-HPA063591) | |
Datasheet | Anti VSTM5 pAb (ATL-HPA063591) Datasheet (External Link) |
Vendor Page | Anti VSTM5 pAb (ATL-HPA063591) |