Polyclonal Antibody against Human VSIG4, Gene description: V-set and immunoglobulin domain containing 4, Alternative Gene Names: CRIg, Z39IG, Validated applications: IHC, WB, Uniprot ID: Q9Y279, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC, WB |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | KGDVNLPCTYDPLQGYTQVLVKWLVQRGSDPVTIFLRDSSGDHIQQAKYQGRLHVSHKVPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVV |
Gene ID - Mouse | ENSMUSG00000044206 |
Gene ID - Rat | ENSMUSG00000044206 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti-VSIG4 pAb (ATL-HPA072756) | |
Vendor Page | Anti-VSIG4 pAb (ATL-HPA072756) at Atlas |
Documents & Links for Anti-VSIG4 pAb (ATL-HPA072756) | |
Vendor Page | Anti-VSIG4 pAb (ATL-HPA072756) |