Anti-VSIG4 pAb (ATL-HPA072756)

Catalog No:
ATL-HPA072756-100
$596.00
Polyclonal Antibody against Human VSIG4, Gene description: V-set and immunoglobulin domain containing 4, Alternative Gene Names: CRIg, Z39IG, Validated applications: IHC, WB, Uniprot ID: Q9Y279, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC, WB
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence KGDVNLPCTYDPLQGYTQVLVKWLVQRGSDPVTIFLRDSSGDHIQQAKYQGRLHVSHKVPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVV
Gene ID - Mouse ENSMUSG00000044206
Gene ID - Rat ENSMUSG00000044206
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Documents & Links for Anti-VSIG4 pAb (ATL-HPA072756)
Vendor Page Anti-VSIG4 pAb (ATL-HPA072756) at Atlas

Documents & Links for Anti-VSIG4 pAb (ATL-HPA072756)
Vendor Page Anti-VSIG4 pAb (ATL-HPA072756)