Anti-VSIG4 pAb (ATL-HPA072756)

Atlas Antibodies

Catalog No: ATL-HPA072756-100

• 
• 

Polyclonal Antibody against Human VSIG4, Gene description: V-set and immunoglobulin domain containing 4, Alternative Gene Names: CRIg, Z39IG, Validated applications: IHC, WB, Uniprot ID: Q9Y279, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC, WB
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Gene Sequence: KGDVNLPCTYDPLQGYTQVLVKWLVQRGSDPVTIFLRDSSGDHIQQAKYQGRLHVSHKVPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVV
• Gene ID - Mouse: ENSMUSG00000044206
• Gene ID - Rat: ENSMUSG00000044206
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.