Anti VSIG2 pAb (ATL-HPA050147 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA050147-100

• 
• 

Protein Description: V-set and immunoglobulin domain containing 2
Gene Name: VSIG2
Alternative Gene Name: CTH, CTXL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001943: 70%, ENSRNOG00000033490: 74%
Entrez Gene ID: 23584
Uniprot ID: Q96IQ7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GKKPKETYGGSDLREDAIAPGISEHTCMRADSSKGFLERPSSASTVTTTKSKLPMVV
• Gene Sequence: GKKPKETYGGSDLREDAIAPGISEHTCMRADSSKGFLERPSSASTVTTTKSKLPMVV
• Gene ID - Mouse: ENSMUSG00000001943
• Gene ID - Rat: ENSRNOG00000033490
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.