Anti VRK3 pAb (ATL-HPA056489)
Atlas Antibodies
- SKU:
- ATL-HPA056489-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: VRK3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002205: 68%, ENSRNOG00000026517: 73%
Entrez Gene ID: 51231
Uniprot ID: Q8IV63
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | CPYCGNSLPVEEHVGSQTFVNPHVSSFQGSKRGLNSSFETSPKKVKWSSTVTSPRLSLFSDGDSSESEDTLSS |
Gene Sequence | CPYCGNSLPVEEHVGSQTFVNPHVSSFQGSKRGLNSSFETSPKKVKWSSTVTSPRLSLFSDGDSSESEDTLSS |
Gene ID - Mouse | ENSMUSG00000002205 |
Gene ID - Rat | ENSRNOG00000026517 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti VRK3 pAb (ATL-HPA056489) | |
Datasheet | Anti VRK3 pAb (ATL-HPA056489) Datasheet (External Link) |
Vendor Page | Anti VRK3 pAb (ATL-HPA056489) at Atlas Antibodies |
Documents & Links for Anti VRK3 pAb (ATL-HPA056489) | |
Datasheet | Anti VRK3 pAb (ATL-HPA056489) Datasheet (External Link) |
Vendor Page | Anti VRK3 pAb (ATL-HPA056489) |