Anti VRK3 pAb (ATL-HPA056489)

Atlas Antibodies

SKU:
ATL-HPA056489-25
  • Immunohistochemical staining of human duodenum shows moderate nuclear and weak cytoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line A549 shows localization to nucleus, nucleoli & vesicles.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: vaccinia related kinase 3
Gene Name: VRK3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002205: 68%, ENSRNOG00000026517: 73%
Entrez Gene ID: 51231
Uniprot ID: Q8IV63
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CPYCGNSLPVEEHVGSQTFVNPHVSSFQGSKRGLNSSFETSPKKVKWSSTVTSPRLSLFSDGDSSESEDTLSS
Gene Sequence CPYCGNSLPVEEHVGSQTFVNPHVSSFQGSKRGLNSSFETSPKKVKWSSTVTSPRLSLFSDGDSSESEDTLSS
Gene ID - Mouse ENSMUSG00000002205
Gene ID - Rat ENSRNOG00000026517
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti VRK3 pAb (ATL-HPA056489)
Datasheet Anti VRK3 pAb (ATL-HPA056489) Datasheet (External Link)
Vendor Page Anti VRK3 pAb (ATL-HPA056489) at Atlas Antibodies

Documents & Links for Anti VRK3 pAb (ATL-HPA056489)
Datasheet Anti VRK3 pAb (ATL-HPA056489) Datasheet (External Link)
Vendor Page Anti VRK3 pAb (ATL-HPA056489)