Anti VPS72 pAb (ATL-HPA065709)

Atlas Antibodies

SKU: ATL-HPA065709-25

• 

Protein Description: vacuolar protein sorting 72 homolog (S. cerevisiae)
Gene Name: VPS72
Alternative Gene Name: Swc2, TCFL1, YL-1, YL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000008958: 100%, ENSRNOG00000021081: 100%
Entrez Gene ID: 6944
Uniprot ID: Q15906
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, ChIP-Exo-Seq
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RKTAGNRLSGLLEAEEEDEFYQTTYGGFTEESGDDEYQGDQSDTEDEVDSDFDIDEGDEPSSDGEAEE
• Gene Sequence: RKTAGNRLSGLLEAEEEDEFYQTTYGGFTEESGDDEYQGDQSDTEDEVDSDFDIDEGDEPSSDGEAEE
• Gene ID - Mouse: ENSMUSG00000008958
• Gene ID - Rat: ENSRNOG00000021081
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.