Protein Description: vacuolar protein sorting 72 homolog (S. cerevisiae)
Gene Name: VPS72
Alternative Gene Name: Swc2, TCFL1, YL-1, YL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000008958: 100%, ENSRNOG00000021081: 100%
Entrez Gene ID: 6944
Uniprot ID: Q15906
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: VPS72
Alternative Gene Name: Swc2, TCFL1, YL-1, YL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000008958: 100%, ENSRNOG00000021081: 100%
Entrez Gene ID: 6944
Uniprot ID: Q15906
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | RKTAGNRLSGLLEAEEEDEFYQTTYGGFTEESGDDEYQGDQSDTEDEVDSDFDIDEGDEPSSDGEAEE |
| Documents & Links for Anti VPS72 pAb (ATL-HPA065709) | |
| Datasheet | Anti VPS72 pAb (ATL-HPA065709) Datasheet (External Link) |
| Vendor Page | Anti VPS72 pAb (ATL-HPA065709) at Atlas |
| Documents & Links for Anti VPS72 pAb (ATL-HPA065709) | |
| Datasheet | Anti VPS72 pAb (ATL-HPA065709) Datasheet (External Link) |
| Vendor Page | Anti VPS72 pAb (ATL-HPA065709) |