Anti VPS25 pAb (ATL-HPA052217)

Atlas Antibodies

SKU: ATL-HPA052217-25

• 
• 

Protein Description: vacuolar protein sorting 25 homolog (S. cerevisiae)
Gene Name: VPS25
Alternative Gene Name: DERP9, EAP20, MGC10540
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078656: 100%, ENSRNOG00000051179: 100%
Entrez Gene ID: 84313
Uniprot ID: Q9BRG1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AMSFEWPWQYRFPPFFTLQPNVDTRQKQLAAWCSLVLSFCRLHKQSSMTVMEAQESPLFNNVKLQRKLPVESIQIVL
• Gene Sequence: AMSFEWPWQYRFPPFFTLQPNVDTRQKQLAAWCSLVLSFCRLHKQSSMTVMEAQESPLFNNVKLQRKLPVESIQIVL
• Gene ID - Mouse: ENSMUSG00000078656
• Gene ID - Rat: ENSRNOG00000051179
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.