Anti VPS16 pAb (ATL-HPA048661)

Atlas Antibodies

SKU:
ATL-HPA048661-25
  • Immunohistochemical staining of human rectum shows strong granular cytoplasmic positivity in glandular cells.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: vacuolar protein sorting 16 homolog (S. cerevisiae)
Gene Name: VPS16
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027411: 99%, ENSRNOG00000021222: 99%
Entrez Gene ID: 64601
Uniprot ID: Q9H269
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LLLKMKRSKLALSKAIESGDTDLVFTVLLHLKNELNRGDFFMTLRNQPMALSLYRQFCKHQELETLKDLYNQDDNHQELGSFHIRASYAAEERIEGRVAALQ
Gene Sequence LLLKMKRSKLALSKAIESGDTDLVFTVLLHLKNELNRGDFFMTLRNQPMALSLYRQFCKHQELETLKDLYNQDDNHQELGSFHIRASYAAEERIEGRVAALQ
Gene ID - Mouse ENSMUSG00000027411
Gene ID - Rat ENSRNOG00000021222
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti VPS16 pAb (ATL-HPA048661)
Datasheet Anti VPS16 pAb (ATL-HPA048661) Datasheet (External Link)
Vendor Page Anti VPS16 pAb (ATL-HPA048661) at Atlas Antibodies

Documents & Links for Anti VPS16 pAb (ATL-HPA048661)
Datasheet Anti VPS16 pAb (ATL-HPA048661) Datasheet (External Link)
Vendor Page Anti VPS16 pAb (ATL-HPA048661)