Anti VPS13D pAb (ATL-HPA051621)
Atlas Antibodies
- SKU:
- ATL-HPA051621-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: VPS13D
Alternative Gene Name: FLJ10619, KIAA0453
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020220: 100%, ENSRNOG00000016443: 99%
Entrez Gene ID: 55187
Uniprot ID: Q5THJ4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | WSGGFEVNKNNSFHINMRDTLGKCFFLRVEITLRGATYRISFSDTDQLPPPFRIDNFSKVPVVFTQHGVAEPRLRTEVKPM |
Gene Sequence | WSGGFEVNKNNSFHINMRDTLGKCFFLRVEITLRGATYRISFSDTDQLPPPFRIDNFSKVPVVFTQHGVAEPRLRTEVKPM |
Gene ID - Mouse | ENSMUSG00000020220 |
Gene ID - Rat | ENSRNOG00000016443 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti VPS13D pAb (ATL-HPA051621) | |
Datasheet | Anti VPS13D pAb (ATL-HPA051621) Datasheet (External Link) |
Vendor Page | Anti VPS13D pAb (ATL-HPA051621) at Atlas Antibodies |
Documents & Links for Anti VPS13D pAb (ATL-HPA051621) | |
Datasheet | Anti VPS13D pAb (ATL-HPA051621) Datasheet (External Link) |
Vendor Page | Anti VPS13D pAb (ATL-HPA051621) |