Anti VPS13D pAb (ATL-HPA051621)

Atlas Antibodies

SKU: ATL-HPA051621-25

• 

Protein Description: vacuolar protein sorting 13 homolog D (S. cerevisiae)
Gene Name: VPS13D
Alternative Gene Name: FLJ10619, KIAA0453
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020220: 100%, ENSRNOG00000016443: 99%
Entrez Gene ID: 55187
Uniprot ID: Q5THJ4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: WSGGFEVNKNNSFHINMRDTLGKCFFLRVEITLRGATYRISFSDTDQLPPPFRIDNFSKVPVVFTQHGVAEPRLRTEVKPM
• Gene Sequence: WSGGFEVNKNNSFHINMRDTLGKCFFLRVEITLRGATYRISFSDTDQLPPPFRIDNFSKVPVVFTQHGVAEPRLRTEVKPM
• Gene ID - Mouse: ENSMUSG00000020220
• Gene ID - Rat: ENSRNOG00000016443
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.