Anti VPREB1 pAb (ATL-HPA055886)

Atlas Antibodies

SKU:
ATL-HPA055886-25
  • Immunohistochemical staining of human bone marrow shows moderate nuclear positivity in hematopoietic cells.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: pre-B lymphocyte 1
Gene Name: VPREB1
Alternative Gene Name: CD179A, VpreB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059280: 76%, ENSRNOG00000052348: 75%
Entrez Gene ID: 7441
Uniprot ID: P12018
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QPVLHQPPAMSSALGTTIRLTCTLRNDHDIGVYSVYWYQQRPGHPPRFLLRYFSQSDKSQGPQVPPRFSGSKDVARNRGYLSISELQPEDEAMYYCAMGARSSEKEEREREWEEEMEPT
Gene Sequence QPVLHQPPAMSSALGTTIRLTCTLRNDHDIGVYSVYWYQQRPGHPPRFLLRYFSQSDKSQGPQVPPRFSGSKDVARNRGYLSISELQPEDEAMYYCAMGARSSEKEEREREWEEEMEPT
Gene ID - Mouse ENSMUSG00000059280
Gene ID - Rat ENSRNOG00000052348
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti VPREB1 pAb (ATL-HPA055886)
Datasheet Anti VPREB1 pAb (ATL-HPA055886) Datasheet (External Link)
Vendor Page Anti VPREB1 pAb (ATL-HPA055886) at Atlas Antibodies

Documents & Links for Anti VPREB1 pAb (ATL-HPA055886)
Datasheet Anti VPREB1 pAb (ATL-HPA055886) Datasheet (External Link)
Vendor Page Anti VPREB1 pAb (ATL-HPA055886)