Protein Description: vitamin D receptor
Gene Name: VDR
Alternative Gene Name: NR1I1, PPP1R163
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022479: 86%, ENSRNOG00000054420: 89%
Entrez Gene ID: 7421
Uniprot ID: P11473
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: VDR
Alternative Gene Name: NR1I1, PPP1R163
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022479: 86%, ENSRNOG00000054420: 89%
Entrez Gene ID: 7421
Uniprot ID: P11473
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | PGFRDLTSEDQIVLLKSSAIEVIMLRSNESFTMDDMSWTCGNQDYKYRVSDVTKAGHSLELIEPLIKFQVGLKKLN |
| Documents & Links for Anti VDR pAb (ATL-HPA072102) | |
| Datasheet | Anti VDR pAb (ATL-HPA072102) Datasheet (External Link) |
| Vendor Page | Anti VDR pAb (ATL-HPA072102) at Atlas |
| Documents & Links for Anti VDR pAb (ATL-HPA072102) | |
| Datasheet | Anti VDR pAb (ATL-HPA072102) Datasheet (External Link) |
| Vendor Page | Anti VDR pAb (ATL-HPA072102) |