Protein Description: valosin containing protein lysine methyltransferase
Gene Name: VCPKMT
Alternative Gene Name: C14orf138, METTL21D, VCP-KMT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049882: 85%, ENSRNOG00000021433: 27%
Entrez Gene ID: 79609
Uniprot ID: Q9H867
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: VCPKMT
Alternative Gene Name: C14orf138, METTL21D, VCP-KMT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049882: 85%, ENSRNOG00000021433: 27%
Entrez Gene ID: 79609
Uniprot ID: Q9H867
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | EIEGFPSPPDFILMADCIYYEESLEPLLKTLKDISGFETCIICCYEQRTMGKNPEIEKKYFELLQLDFDFEKIPLEKHDEEYRSEDIHIIYIRKK |
Documents & Links for Anti VCPKMT pAb (ATL-HPA076561) | |
Datasheet | Anti VCPKMT pAb (ATL-HPA076561) Datasheet (External Link) |
Vendor Page | Anti VCPKMT pAb (ATL-HPA076561) at Atlas |
Documents & Links for Anti VCPKMT pAb (ATL-HPA076561) | |
Datasheet | Anti VCPKMT pAb (ATL-HPA076561) Datasheet (External Link) |
Vendor Page | Anti VCPKMT pAb (ATL-HPA076561) |