Anti VCPKMT pAb (ATL-HPA076561)

Atlas Antibodies

SKU: ATL-HPA076561-25

• 

Product Description

Protein Description: valosin containing protein lysine methyltransferase
Gene Name: VCPKMT
Alternative Gene Name: C14orf138, METTL21D, VCP-KMT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049882: 85%, ENSRNOG00000021433: 27%
Entrez Gene ID: 79609
Uniprot ID: Q9H867
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EIEGFPSPPDFILMADCIYYEESLEPLLKTLKDISGFETCIICCYEQRTMGKNPEIEKKYFELLQLDFDFEKIPLEKHDEEYRSEDIHIIYIRKK
• Gene Sequence: EIEGFPSPPDFILMADCIYYEESLEPLLKTLKDISGFETCIICCYEQRTMGKNPEIEKKYFELLQLDFDFEKIPLEKHDEEYRSEDIHIIYIRKK
• Gene ID - Mouse: ENSMUSG00000049882
• Gene ID - Rat: ENSRNOG00000021433
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links