Anti VAT1 pAb (ATL-HPA045170)

Atlas Antibodies

SKU: ATL-HPA045170-25

• 
• 

Protein Description: vesicle amine transport 1
Gene Name: VAT1
Alternative Gene Name: FLJ20230, VATI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034993: 95%, ENSRNOG00000020684: 95%
Entrez Gene ID: 10493
Uniprot ID: Q99536
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GDRVMVLNRSGMWQEEVTVPSVQTFLIPEAMTFEEAAALLVNYITAYMVLFDFGNLQPGHSVLVH
• Gene Sequence: GDRVMVLNRSGMWQEEVTVPSVQTFLIPEAMTFEEAAALLVNYITAYMVLFDFGNLQPGHSVLVH
• Gene ID - Mouse: ENSMUSG00000034993
• Gene ID - Rat: ENSRNOG00000020684
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.