Anti VAMP4 pAb (ATL-HPA050418 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA050418-25
  • Immunohistochemistry analysis in human cerebral cortex and skeletal muscle tissues using HPA050418 antibody. Corresponding VAMP4 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line A-431 shows localization to the Golgi apparatus.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: vesicle-associated membrane protein 4
Gene Name: VAMP4
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026696: 100%, ENSRNOG00000003071: 100%
Entrez Gene ID: 8674
Uniprot ID: O75379
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MPPKFKRHLNDDDVTGSVKSERRNLLEDDSDEEEDFFLRGPSGPRFGPRNDK
Gene Sequence MPPKFKRHLNDDDVTGSVKSERRNLLEDDSDEEEDFFLRGPSGPRFGPRNDK
Gene ID - Mouse ENSMUSG00000026696
Gene ID - Rat ENSRNOG00000003071
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti VAMP4 pAb (ATL-HPA050418 w/enhanced validation)
Datasheet Anti VAMP4 pAb (ATL-HPA050418 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti VAMP4 pAb (ATL-HPA050418 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti VAMP4 pAb (ATL-HPA050418 w/enhanced validation)
Datasheet Anti VAMP4 pAb (ATL-HPA050418 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti VAMP4 pAb (ATL-HPA050418 w/enhanced validation)



Citations for Anti VAMP4 pAb (ATL-HPA050418 w/enhanced validation) – 1 Found
Postema, Meagan M; Grega-Larson, Nathan E; Meenderink, Leslie M; Tyska, Matthew J. PACSIN2-dependent apical endocytosis regulates the morphology of epithelial microvilli. Molecular Biology Of The Cell. 2019;30(19):2515-2526.  PubMed
!