Anti UTP20 pAb (ATL-HPA049341)

Catalog No:
ATL-HPA049341-25
$447.00
Protein Description: UTP20 small subunit (SSU) processome component
Gene Name: UTP20
Alternative Gene Name: 1A6/DRIM, DRIM
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004356: 81%, ENSRNOG00000005823: 81%
Entrez Gene ID: 27340
Uniprot ID: O75691
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence FETLSDFESGLKYITDVVKLNAFDQRHLDDINFDVRFETFQTITSYIKEMQIVDVNYLIPVMHNCFYNLELGDMSLSDNASMC
Gene ID - Mouse ENSMUSG00000004356
Gene ID - Rat ENSMUSG00000004356
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Documents & Links for Anti UTP20 pAb (ATL-HPA049341)
Datasheet Anti UTP20 pAb (ATL-HPA049341) Datasheet (External Link)
Vendor Page Anti UTP20 pAb (ATL-HPA049341) at Atlas

Documents & Links for Anti UTP20 pAb (ATL-HPA049341)
Datasheet Anti UTP20 pAb (ATL-HPA049341) Datasheet (External Link)
Vendor Page Anti UTP20 pAb (ATL-HPA049341)