Anti UTP20 pAb (ATL-HPA049341)
Atlas Antibodies
- SKU:
- ATL-HPA049341-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: UTP20
Alternative Gene Name: 1A6/DRIM, DRIM
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004356: 81%, ENSRNOG00000005823: 81%
Entrez Gene ID: 27340
Uniprot ID: O75691
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FETLSDFESGLKYITDVVKLNAFDQRHLDDINFDVRFETFQTITSYIKEMQIVDVNYLIPVMHNCFYNLELGDMSLSDNASMC |
Gene Sequence | FETLSDFESGLKYITDVVKLNAFDQRHLDDINFDVRFETFQTITSYIKEMQIVDVNYLIPVMHNCFYNLELGDMSLSDNASMC |
Gene ID - Mouse | ENSMUSG00000004356 |
Gene ID - Rat | ENSRNOG00000005823 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti UTP20 pAb (ATL-HPA049341) | |
Datasheet | Anti UTP20 pAb (ATL-HPA049341) Datasheet (External Link) |
Vendor Page | Anti UTP20 pAb (ATL-HPA049341) at Atlas Antibodies |
Documents & Links for Anti UTP20 pAb (ATL-HPA049341) | |
Datasheet | Anti UTP20 pAb (ATL-HPA049341) Datasheet (External Link) |
Vendor Page | Anti UTP20 pAb (ATL-HPA049341) |