Anti UTP11 pAb (ATL-HPA045830)

Atlas Antibodies

SKU: ATL-HPA045830-25

• 
• 
• 

Protein Description: UTP11, small subunit processome component homolog (S. cerevisiae)
Gene Name: UTP11
Alternative Gene Name: CGI-94, UTP11L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028907: 93%, ENSRNOG00000007174: 93%
Entrez Gene ID: 51118
Uniprot ID: Q9Y3A2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HIIKETKEEVTPEQLKLMRTQDVKYIEMKRVAEAKKIERLKSELHLLDFQGKQQNKHVFFFDTKKEVEQFDVATHLQTAPEL
• Gene Sequence: HIIKETKEEVTPEQLKLMRTQDVKYIEMKRVAEAKKIERLKSELHLLDFQGKQQNKHVFFFDTKKEVEQFDVATHLQTAPEL
• Gene ID - Mouse: ENSMUSG00000028907
• Gene ID - Rat: ENSRNOG00000007174
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.