Anti USP37 pAb (ATL-HPA045160)

Atlas Antibodies

SKU:
ATL-HPA045160-25
  • Immunohistochemical staining of human hippocampus shows distinct cytoplasmic positivity in astrocytes.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & nucleoli.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: ubiquitin specific peptidase 37
Gene Name: USP37
Alternative Gene Name: KIAA1594
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033364: 92%, ENSRNOG00000022720: 92%
Entrez Gene ID: 57695
Uniprot ID: Q86T82
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TGITKWKEGSFEIVEKENKVSLVVHYNTGGIPRIFQLSHNIKNVVLRPSGAKQSRLMLTLQDNSFLSIDKVPSKDAEEMRLFLDAVHQNRLPAAMKPSQGSGSFGAILGSRTSQKETSR
Gene Sequence TGITKWKEGSFEIVEKENKVSLVVHYNTGGIPRIFQLSHNIKNVVLRPSGAKQSRLMLTLQDNSFLSIDKVPSKDAEEMRLFLDAVHQNRLPAAMKPSQGSGSFGAILGSRTSQKETSR
Gene ID - Mouse ENSMUSG00000033364
Gene ID - Rat ENSRNOG00000022720
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti USP37 pAb (ATL-HPA045160)
Datasheet Anti USP37 pAb (ATL-HPA045160) Datasheet (External Link)
Vendor Page Anti USP37 pAb (ATL-HPA045160) at Atlas Antibodies

Documents & Links for Anti USP37 pAb (ATL-HPA045160)
Datasheet Anti USP37 pAb (ATL-HPA045160) Datasheet (External Link)
Vendor Page Anti USP37 pAb (ATL-HPA045160)



Citations for Anti USP37 pAb (ATL-HPA045160) – 1 Found
Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23.  PubMed