Anti USP35 pAb (ATL-HPA058592)
Atlas Antibodies
- SKU:
- ATL-HPA058592-25
- Shipping:
- Calculated at Checkout
$447.00
Product Description
Protein Description: ubiquitin specific peptidase 35
Gene Name: USP35
Alternative Gene Name: KIAA1372
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035713: 93%, ENSRNOG00000024961: 90%
Entrez Gene ID: 57558
Uniprot ID: Q9P2H5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: USP35
Alternative Gene Name: KIAA1372
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035713: 93%, ENSRNOG00000024961: 90%
Entrez Gene ID: 57558
Uniprot ID: Q9P2H5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LYLQEQEKEARSRAAYISALPTSPHWGRGFDEDKDEDEGSPGGCNPAGGNGGDFHRLVF |
Gene Sequence | LYLQEQEKEARSRAAYISALPTSPHWGRGFDEDKDEDEGSPGGCNPAGGNGGDFHRLVF |
Gene ID - Mouse | ENSMUSG00000035713 |
Gene ID - Rat | ENSRNOG00000024961 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti USP35 pAb (ATL-HPA058592) | |
Datasheet | Anti USP35 pAb (ATL-HPA058592) Datasheet (External Link) |
Vendor Page | Anti USP35 pAb (ATL-HPA058592) at Atlas Antibodies |
Documents & Links for Anti USP35 pAb (ATL-HPA058592) | |
Datasheet | Anti USP35 pAb (ATL-HPA058592) Datasheet (External Link) |
Vendor Page | Anti USP35 pAb (ATL-HPA058592) |