Anti USP35 pAb (ATL-HPA058592)

Atlas Antibodies

SKU: ATL-HPA058592-25

• 

Product Description

Protein Description: ubiquitin specific peptidase 35
Gene Name: USP35
Alternative Gene Name: KIAA1372
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035713: 93%, ENSRNOG00000024961: 90%
Entrez Gene ID: 57558
Uniprot ID: Q9P2H5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LYLQEQEKEARSRAAYISALPTSPHWGRGFDEDKDEDEGSPGGCNPAGGNGGDFHRLVF
• Gene Sequence: LYLQEQEKEARSRAAYISALPTSPHWGRGFDEDKDEDEGSPGGCNPAGGNGGDFHRLVF
• Gene ID - Mouse: ENSMUSG00000035713
• Gene ID - Rat: ENSRNOG00000024961
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links