Protein Description: ubiquitin specific peptidase 3
Gene Name: USP3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032376: 99%, ENSRNOG00000017714: 99%
Entrez Gene ID: 9960
Uniprot ID: Q9Y6I4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: USP3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032376: 99%, ENSRNOG00000017714: 99%
Entrez Gene ID: 9960
Uniprot ID: Q9Y6I4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | PFLDLSLDIPSQFRSKRSKNQENGPVCSLRDCLRSFTDLEELDETELYMCHKCKKKQKSTKKFWIQKLPKVLCL |
| Documents & Links for Anti USP3 pAb (ATL-HPA077975) | |
| Datasheet | Anti USP3 pAb (ATL-HPA077975) Datasheet (External Link) |
| Vendor Page | Anti USP3 pAb (ATL-HPA077975) at Atlas |
| Documents & Links for Anti USP3 pAb (ATL-HPA077975) | |
| Datasheet | Anti USP3 pAb (ATL-HPA077975) Datasheet (External Link) |
| Vendor Page | Anti USP3 pAb (ATL-HPA077975) |