Anti USP3 pAb (ATL-HPA077975)
Atlas Antibodies
- SKU:
- ATL-HPA077975-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: USP3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032376: 99%, ENSRNOG00000017714: 99%
Entrez Gene ID: 9960
Uniprot ID: Q9Y6I4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PFLDLSLDIPSQFRSKRSKNQENGPVCSLRDCLRSFTDLEELDETELYMCHKCKKKQKSTKKFWIQKLPKVLCL |
Gene Sequence | PFLDLSLDIPSQFRSKRSKNQENGPVCSLRDCLRSFTDLEELDETELYMCHKCKKKQKSTKKFWIQKLPKVLCL |
Gene ID - Mouse | ENSMUSG00000032376 |
Gene ID - Rat | ENSRNOG00000017714 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti USP3 pAb (ATL-HPA077975) | |
Datasheet | Anti USP3 pAb (ATL-HPA077975) Datasheet (External Link) |
Vendor Page | Anti USP3 pAb (ATL-HPA077975) at Atlas Antibodies |
Documents & Links for Anti USP3 pAb (ATL-HPA077975) | |
Datasheet | Anti USP3 pAb (ATL-HPA077975) Datasheet (External Link) |
Vendor Page | Anti USP3 pAb (ATL-HPA077975) |