Anti USHBP1 pAb (ATL-HPA052471)

Atlas Antibodies

SKU: ATL-HPA052471-25

• 

Protein Description: Usher syndrome 1C binding protein 1
Gene Name: USHBP1
Alternative Gene Name: AIEBP, FLJ38709, MCC2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034911: 55%, ENSRNOG00000023485: 56%
Entrez Gene ID: 83878
Uniprot ID: Q8N6Y0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TLQHTLSSLEAAAAAWRHQPPSHSGPMEFEGTSEGGAGSLGKQEGAGSCQREAARLAERNAWLRLALSSREDELVRTQASLEAIRAEKETLQKEVQELQDSLLRLEPCPHLSHNQAGG
• Gene Sequence: TLQHTLSSLEAAAAAWRHQPPSHSGPMEFEGTSEGGAGSLGKQEGAGSCQREAARLAERNAWLRLALSSREDELVRTQASLEAIRAEKETLQKEVQELQDSLLRLEPCPHLSHNQAGG
• Gene ID - Mouse: ENSMUSG00000034911
• Gene ID - Rat: ENSRNOG00000023485
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.