Anti USF2 pAb (ATL-HPA046567)

Atlas Antibodies

SKU: ATL-HPA046567-25

• 

Protein Description: upstream transcription factor 2, c-fos interacting
Gene Name: USF2
Alternative Gene Name: bHLHb12, FIP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058239: 100%, ENSRNOG00000053725: 100%
Entrez Gene ID: 7392
Uniprot ID: Q15853
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GPAAPFPLAVIQNPFSNGGSPAAEAVSGEARFAYFPASSVGDTTAVSVQTTDQSLQAGGQFYVMMTPQDVLQTGTQRTI
• Gene Sequence: GPAAPFPLAVIQNPFSNGGSPAAEAVSGEARFAYFPASSVGDTTAVSVQTTDQSLQAGGQFYVMMTPQDVLQTGTQRTI
• Gene ID - Mouse: ENSMUSG00000058239
• Gene ID - Rat: ENSRNOG00000053725
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.