Anti URB2 pAb (ATL-HPA046788)

Atlas Antibodies

SKU: ATL-HPA046788-25

• 

Protein Description: URB2 ribosome biogenesis 2 homolog (S. cerevisiae)
Gene Name: URB2
Alternative Gene Name: KIAA0133, NET10, NPA2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031976: 66%, ENSRNOG00000026853: 70%
Entrez Gene ID: 9816
Uniprot ID: Q14146
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PEGAVVAQLFEVIHLALGHYLLILQQQVNPRRAFGDVTAHLLQPCLVLRHLLSGGTWTQAGQGQLRQVLSRDIRSQIEAMFRGGIFQPELLSSYKEGLLDQQQGDVKTGAMKNLLAPMDTVLNRLVDAGYCAASL
• Gene Sequence: PEGAVVAQLFEVIHLALGHYLLILQQQVNPRRAFGDVTAHLLQPCLVLRHLLSGGTWTQAGQGQLRQVLSRDIRSQIEAMFRGGIFQPELLSSYKEGLLDQQQGDVKTGAMKNLLAPMDTVLNRLVDAGYCAASL
• Gene ID - Mouse: ENSMUSG00000031976
• Gene ID - Rat: ENSRNOG00000026853
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.