Anti UQCRQ pAb (ATL-HPA053323)

Atlas Antibodies

SKU: ATL-HPA053323-25

• 

Protein Description: ubiquinol-cytochrome c reductase, complex III subunit VII, 9.5kDa
Gene Name: UQCRQ
Alternative Gene Name: QCR8, QP-C, UQCR7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044894: 70%, ENSRNOG00000048174: 68%
Entrez Gene ID: 27089
Uniprot ID: O14949
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IRESFFRVVPQFVVFYLIYTWGTEEFERSKRKNPAAY
• Gene Sequence: IRESFFRVVPQFVVFYLIYTWGTEEFERSKRKNPAAY
• Gene ID - Mouse: ENSMUSG00000044894
• Gene ID - Rat: ENSRNOG00000048174
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.