Anti UQCRFS1 pAb (ATL-HPA050339 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA050339-25

• 
• 

Protein Description: ubiquinol-cytochrome c reductase, Rieske iron-sulfur polypeptide 1
Gene Name: UQCRFS1
Alternative Gene Name: RIP1, RIS1, RISP, UQCR5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038462: 91%, ENSRNOG00000018281: 91%
Entrez Gene ID: 7386
Uniprot ID: P47985
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VTQFVSSMSASADVLALAKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTQKEIEQEAAVELSQLRDPQHDL
• Gene Sequence: VTQFVSSMSASADVLALAKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTQKEIEQEAAVELSQLRDPQHDL
• Gene ID - Mouse: ENSMUSG00000038462
• Gene ID - Rat: ENSRNOG00000018281
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.