Anti UPP1 pAb (ATL-HPA055394 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA055394-100

• 
• 
• 

Protein Description: uridine phosphorylase 1
Gene Name: UPP1
Alternative Gene Name: UDRPASE, UP, UPASE, UPP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020407: 64%, ENSRNOG00000004972: 63%
Entrez Gene ID: 7378
Uniprot ID: Q16831
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TGANAEKAESHNDCPVRLLNPNIAKMKEDILYHFNLTTSRHNFP
• Gene Sequence: TGANAEKAESHNDCPVRLLNPNIAKMKEDILYHFNLTTSRHNFP
• Gene ID - Mouse: ENSMUSG00000020407
• Gene ID - Rat: ENSRNOG00000004972
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.