Anti UNC80 pAb (ATL-HPA050959)

Atlas Antibodies

SKU: ATL-HPA050959-25

• 

Protein Description: unc-80 homolog, NALCN channel complex subunit
Gene Name: UNC80
Alternative Gene Name: C2orf21, FLJ33496, KIAA1843, UNC-80
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055567: 100%, ENSRNOG00000028362: 100%
Entrez Gene ID: 285175
Uniprot ID: Q8N2C7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KLGKQYEASCVSFERVLVENKLHGLSPALSEAIQSISRWELVQAALPHVLHCTATLLSNRNKLGHQDKLGVAETKLLHTLHWML
• Gene Sequence: KLGKQYEASCVSFERVLVENKLHGLSPALSEAIQSISRWELVQAALPHVLHCTATLLSNRNKLGHQDKLGVAETKLLHTLHWML
• Gene ID - Mouse: ENSMUSG00000055567
• Gene ID - Rat: ENSRNOG00000028362
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.