Protein Description: uromodulin-like 1
Gene Name: UMODL1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054134: 60%, ENSRNOG00000001157: 59%
Entrez Gene ID: 89766
Uniprot ID: Q5DID0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: UMODL1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054134: 60%, ENSRNOG00000001157: 59%
Entrez Gene ID: 89766
Uniprot ID: Q5DID0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | CSGRELCANLEGSYWCVCHQEAPATSPRKLNLEWEDCPPVSDYVVLNVTSDSFQVSWRLNSTQNHTFHVRVYRGMELLRS |
Documents & Links for Anti UMODL1 pAb (ATL-HPA067245) | |
Datasheet | Anti UMODL1 pAb (ATL-HPA067245) Datasheet (External Link) |
Vendor Page | Anti UMODL1 pAb (ATL-HPA067245) at Atlas |
Documents & Links for Anti UMODL1 pAb (ATL-HPA067245) | |
Datasheet | Anti UMODL1 pAb (ATL-HPA067245) Datasheet (External Link) |
Vendor Page | Anti UMODL1 pAb (ATL-HPA067245) |