Anti UHRF1 pAb (ATL-HPA055446 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA055446-25

• 

Protein Description: ubiquitin like with PHD and ring finger domains 1
Gene Name: UHRF1
Alternative Gene Name: FLJ21925, ICBP90, Np95, RNF106, TDRD22
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001228: 70%, ENSRNOG00000048411: 76%
Entrez Gene ID: 29128
Uniprot ID: Q96T88
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RARTIIKWQDLEVGQVVMLNYNPDNPKERGFWYDAEISRKRETRTARELYANVVLGDDSLNDCRIIFVDE
• Gene Sequence: RARTIIKWQDLEVGQVVMLNYNPDNPKERGFWYDAEISRKRETRTARELYANVVLGDDSLNDCRIIFVDE
• Gene ID - Mouse: ENSMUSG00000001228
• Gene ID - Rat: ENSRNOG00000048411
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.